Lineage for d1m57j_ (1m57 J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957840Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
    automatically mapped to Pfam PF07835
  5. 1957841Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)
  6. 1957842Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
    interacts with subunit I and III, function unknown, non-essential for the enzymatic activity
  7. 1957845Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)
  8. 1957849Domain d1m57j_: 1m57 J: [74490]
    Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57c_, d1m57g_, d1m57h1, d1m57h2, d1m57i_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57j_

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))
PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57j_ f.23.8.1 (J:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

SCOPe Domain Coordinates for d1m57j_:

Click to download the PDB-style file with coordinates for d1m57j_.
(The format of our PDB-style files is described here.)

Timeline for d1m57j_: