![]() | Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) ![]() |
![]() | Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein) |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species) interacts with subunit I and III, function unknown, non-essential for the enzymatic activity |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries) |
![]() | Domain d1m57j_: 1m57 J: [74490] Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57c_, d1m57g_, d1m57h1, d1m57h2, d1m57i_ complexed with ca, cu, hea, mg, peh; mutant |
PDB Entry: 1m57 (more details), 3 Å
SCOP Domain Sequences for d1m57j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m57j_ f.23.8.1 (J:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides} ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
Timeline for d1m57j_: