Lineage for d1m57i_ (1m57 I:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746159Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 746160Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 746161Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 746162Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 746165Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries)
  8. 746169Domain d1m57i_: 1m57 I: [74489]
    Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57d_, d1m57g_, d1m57h1, d1m57h2, d1m57j_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57i_

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))
PDB Compounds: (I:) cytochrome c oxidase

SCOP Domain Sequences for d1m57i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57i_ f.25.1.1 (I:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]}
ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd
vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp
pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf
qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe
aaiwywhfvdvvwlflfasiyiwgq

SCOP Domain Coordinates for d1m57i_:

Click to download the PDB-style file with coordinates for d1m57i_.
(The format of our PDB-style files is described here.)

Timeline for d1m57i_: