SCOPe 2.08: Domain d1m57h1: 1m57 H:130-289

Lineage for d1m57h1 (1m57 H:130-289)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries)

8. Domain d1m57h1: 1m57 H:130-289 [74487]
   Other proteins in same PDB: d1m57a_, d1m57b2, d1m57c_, d1m57d_, d1m57g_, d1m57h2, d1m57i_, d1m57j_
   complexed with 3pe, ca, cu, hea, mg; mutant

Details for d1m57h1

PDB Entry: 1m57, 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))

PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57h1:

Sequence; same for both SEQRES and ATOM records:

>d1m57h1 b.6.1.2 (H:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqarggtyel

Timeline for d1m57h1:

• d1m57h1 first appeared in SCOP 1.61
  
• d1m57h1 appears in SCOPe 2.07