Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries) |
Domain d1m57c_: 1m57 C: [74484] Other proteins in same PDB: d1m57a_, d1m57b1, d1m57b2, d1m57d_, d1m57g_, d1m57h1, d1m57h2, d1m57j_ complexed with ca, cu, hea, mg, peh; mutant |
PDB Entry: 1m57 (more details), 3 Å
SCOPe Domain Sequences for d1m57c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m57c_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]} ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe aaiwywhfvdvvwlflfasiyiwgq
Timeline for d1m57c_: