Lineage for d1m57b2 (1m57 B:30-129)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1697048Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1697049Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1697050Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 1697056Species Rhodobacter sphaeroides [TaxId:1063] [81457] (6 PDB entries)
  8. 1697067Domain d1m57b2: 1m57 B:30-129 [74483]
    Other proteins in same PDB: d1m57a_, d1m57b1, d1m57c_, d1m57d_, d1m57g_, d1m57h1, d1m57i_, d1m57j_
    complexed with ca, cu, hea, mg, peh; mutant

Details for d1m57b2

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1m57b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57b2 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d1m57b2:

Click to download the PDB-style file with coordinates for d1m57b2.
(The format of our PDB-style files is described here.)

Timeline for d1m57b2: