Lineage for d1m57b2 (1m57 B:30-129)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201689Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 201690Protein Cytochrome c oxidase [56884] (4 species)
  7. 201799Species Rhodobacter sphaeroides [TaxId:1063] [75639] (2 PDB entries)
  8. 201809Domain d1m57b2: 1m57 B:30-129 [74483]
    Other proteins in same PDB: d1m57b1, d1m57h1

Details for d1m57b2

PDB Entry: 1m57 (more details), 3 Å

PDB Description: structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i- 286) mutant))

SCOP Domain Sequences for d1m57b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57b2 f.2.1.3 (B:30-129) Cytochrome c oxidase {Rhodobacter sphaeroides}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOP Domain Coordinates for d1m57b2:

Click to download the PDB-style file with coordinates for d1m57b2.
(The format of our PDB-style files is described here.)

Timeline for d1m57b2: