![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [74870] (2 PDB entries) |
![]() | Domain d1m57b1: 1m57 B:130-289 [74482] Other proteins in same PDB: d1m57a_, d1m57b2, d1m57c_, d1m57d_, d1m57g_, d1m57h2, d1m57i_, d1m57j_ |
PDB Entry: 1m57 (more details), 3 Å
SCOP Domain Sequences for d1m57b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m57b1 b.6.1.2 (B:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleqarggtyel
Timeline for d1m57b1: