Lineage for d1m57a_ (1m57 A:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426591Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 426592Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 426593Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 426594Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 426598Species Rhodobacter sphaeroides [TaxId:1063] [81435] (2 PDB entries)
  8. 426601Domain d1m57a_: 1m57 A: [74481]
    Other proteins in same PDB: d1m57b1, d1m57b2, d1m57c_, d1m57d_, d1m57h1, d1m57h2, d1m57i_, d1m57j_

Details for d1m57a_

PDB Entry: 1m57 (more details), 3 Å

PDB Description: Structure of cytochrome c oxidase from Rhodobacter sphaeroides (EQ(I-286) mutant))

SCOP Domain Sequences for d1m57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m57a_ f.24.1.1 (A:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides}
rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
ltdrnfgttffqpsgggdpvlyqhilwffghpqvyiivlpafgivshviatfakkpifgy
lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
lpkredw

SCOP Domain Coordinates for d1m57a_:

Click to download the PDB-style file with coordinates for d1m57a_.
(The format of our PDB-style files is described here.)

Timeline for d1m57a_: