SCOP 1.61: Domain d1m56j1: 1m56 J:

Lineage for d1m56j1 (1m56 J:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Cytochrome c oxidase [56884] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [75639] (2 PDB entries)

8. Domain d1m56j1: 1m56 J: [74480]
   Other proteins in same PDB: d1m56b1, d1m56h1

Details for d1m56j1

PDB Entry: 1m56, 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

SCOP Domain Sequences for d1m56j1:

Sequence; same for both SEQRES and ATOM records:

>d1m56j1 f.2.1.3 (J:) Cytochrome c oxidase {Rhodobacter sphaeroides}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

Timeline for d1m56j1:

• d1m56j1 is new in SCOP 1.61
  
• d1m56j1 is called d1m56j_ in SCOP 1.63
  
• d1m56j1 appears in the current release, SCOPe 2.08, called d1m56j_