![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81447] (2 PDB entries) |
![]() | Domain d1m56i_: 1m56 I: [74479] Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56d_, d1m56g_, d1m56h1, d1m56h2, d1m56j_ complexed with 3pe, ca, cu, hea, mg |
PDB Entry: 1m56 (more details), 2.3 Å
SCOPe Domain Sequences for d1m56i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56i_ f.25.1.1 (I:) Bacterial aa3 type cytochrome c oxidase subunit III {Rhodobacter sphaeroides [TaxId: 1063]} ahaknhdyhilppsiwpfmasvgafvmlfgavlwmhgsgpwmgliglvvvlytmfgwwsd vvteslegdhtpvvrlglrwgfilfimsevmffsawfwsffkhalypmgpespiidgifp pegiitfdpwhlplintlillcsgcaatwahhalvhennrrdvawglalaialgalftvf qayeyshaafgfagniyganffmatgfhgfhvivgtifllvclirvqrghftpekhvgfe aaiwywhfvdvvwlflfasiyiwgq
Timeline for d1m56i_: