![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
![]() | Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81457] (6 PDB entries) |
![]() | Domain d1m56h2: 1m56 H:30-129 [74478] Other proteins in same PDB: d1m56a_, d1m56b1, d1m56c_, d1m56d_, d1m56g_, d1m56h1, d1m56i_, d1m56j_ complexed with ca, cu, hea, mg, peh |
PDB Entry: 1m56 (more details), 2.3 Å
SCOPe Domain Sequences for d1m56h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d1m56h2: