Lineage for d1m56h2 (1m56 H:30-129)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745255Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
    two antiparallel transmembrane helices
  4. 745277Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 745278Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 745279Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 745283Species Rhodobacter sphaeroides [TaxId:1063] [81457] (3 PDB entries)
  8. 745287Domain d1m56h2: 1m56 H:30-129 [74478]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56c_, d1m56d_, d1m56g_, d1m56h1, d1m56i_, d1m56j_
    complexed with ca, cu, hea, mg, peh

Details for d1m56h2

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (H:) cytochrome c oxidase

SCOP Domain Sequences for d1m56h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOP Domain Coordinates for d1m56h2:

Click to download the PDB-style file with coordinates for d1m56h2.
(The format of our PDB-style files is described here.)

Timeline for d1m56h2: