Lineage for d1m56h2 (1m56 H:30-129)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries)
  8. Domain d1m56h2: 1m56 H:30-129 [74478]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56c_, d1m56d_, d1m56g_, d1m56h1, d1m56i_, d1m56j_
    complexed with 3pe, ca, cu, hea, mg

Details for d1m56h2

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (H:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56h2 f.17.2.1 (H:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d1m56h2 are not available.

Timeline for d1m56h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m56h1
View in 3D
Domains from other chains:
(mouse over for more information)
d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56d_, d1m56g_, d1m56i_, d1m56j_