Lineage for d1m56g_ (1m56 G:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1238860Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 1238861Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 1238862Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 1238863Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 1238867Species Rhodobacter sphaeroides [TaxId:1063] [81435] (6 PDB entries)
  8. 1238877Domain d1m56g_: 1m56 G: [74476]
    Other proteins in same PDB: d1m56b1, d1m56b2, d1m56c_, d1m56d_, d1m56h1, d1m56h2, d1m56i_, d1m56j_
    complexed with ca, cu, hea, mg, peh

Details for d1m56g_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (G:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56g_ f.24.1.1 (G:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides [TaxId: 1063]}
rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
ltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgy
lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
lpkredw

SCOPe Domain Coordinates for d1m56g_:

Click to download the PDB-style file with coordinates for d1m56g_.
(The format of our PDB-style files is described here.)

Timeline for d1m56g_: