Lineage for d1m56g_ (1m56 G:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268317Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 268318Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 268319Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 268320Protein Bacterial aa3 type cytochrome c oxidase subunit I [81436] (2 species)
  7. 268324Species Rhodobacter sphaeroides [TaxId:1063] [81435] (2 PDB entries)
  8. 268326Domain d1m56g_: 1m56 G: [74476]
    Other proteins in same PDB: d1m56b1, d1m56b2, d1m56c_, d1m56d_, d1m56h1, d1m56h2, d1m56i_, d1m56j_
    complexed with ca, cu, hea, mg, peh

Details for d1m56g_

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: Structure of cytochrome c oxidase from Rhodobactor sphaeroides (Wild Type)

SCOP Domain Sequences for d1m56g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56g_ f.24.1.1 (G:) Bacterial aa3 type cytochrome c oxidase subunit I {Rhodobacter sphaeroides}
rgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglv
kgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdm
afprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifa
vhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitml
ltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgy
lpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwgg
sielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgif
agiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatw
nfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfeq
lpkredw

SCOP Domain Coordinates for d1m56g_:

Click to download the PDB-style file with coordinates for d1m56g_.
(The format of our PDB-style files is described here.)

Timeline for d1m56g_: