SCOPe 2.04: Domain d1m56d_: 1m56 D:

Lineage for d1m56d_ (1m56 D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family)
   automatically mapped to Pfam PF07835

5. Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species)
   interacts with subunit I and III, function unknown, non-essential for the enzymatic activity

7. Species Rhodobacter sphaeroides [TaxId:1063] [81466] (2 PDB entries)

8. Domain d1m56d_: 1m56 D: [74475]
   Other proteins in same PDB: d1m56a_, d1m56b1, d1m56b2, d1m56c_, d1m56g_, d1m56h1, d1m56h2, d1m56i_
   complexed with ca, cu, hea, mg, peh

Details for d1m56d_

PDB Entry: 1m56, 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

PDB Compounds: (D:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56d_:

Sequence; same for both SEQRES and ATOM records:

>d1m56d_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Rhodobacter sphaeroides [TaxId: 1063]}
ghvagsmditqqektfagfvrmvtwaavvivaaliflalana

Timeline for d1m56d_:

• d1m56d_ first appeared in SCOP 1.61, called d1m56d1
  
• d1m56d_ appears in SCOPe 2.03
  
• d1m56d_ appears in SCOPe 2.05
  
• d1m56d_ appears in the current release, SCOPe 2.08