![]() | Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (13 families) ![]() |
![]() | Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
![]() | Protein Cytochrome c oxidase [56884] (4 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [75639] (2 PDB entries) |
![]() | Domain d1m56d1: 1m56 D: [74475] Other proteins in same PDB: d1m56b1, d1m56h1 |
PDB Entry: 1m56 (more details), 2.3 Å
SCOP Domain Sequences for d1m56d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m56d1 f.2.1.3 (D:) Cytochrome c oxidase {Rhodobacter sphaeroides} ghvagsmditqqektfagfvrmvtwaavvivaaliflalana
Timeline for d1m56d1: