Lineage for d1m56b2 (1m56 B:30-129)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620028Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 620050Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 620051Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 620052Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 620056Species Rhodobacter sphaeroides [TaxId:1063] [81457] (2 PDB entries)
  8. 620057Domain d1m56b2: 1m56 B:30-129 [74473]
    Other proteins in same PDB: d1m56a_, d1m56b1, d1m56c_, d1m56d_, d1m56g_, d1m56h1, d1m56i_, d1m56j_

Details for d1m56b2

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

SCOP Domain Sequences for d1m56b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56b2 f.17.2.1 (B:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOP Domain Coordinates for d1m56b2:

Click to download the PDB-style file with coordinates for d1m56b2.
(The format of our PDB-style files is described here.)

Timeline for d1m56b2: