Lineage for d1m56b1 (1m56 B:130-289)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528013Protein Cytochrome c oxidase [49544] (4 species)
  7. 1528070Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)
  8. 1528079Domain d1m56b1: 1m56 B:130-289 [74472]
    Other proteins in same PDB: d1m56a_, d1m56b2, d1m56c_, d1m56d_, d1m56g_, d1m56h2, d1m56i_, d1m56j_
    complexed with ca, cu, hea, mg, peh

Details for d1m56b1

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56b1 b.6.1.2 (B:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqarggtyel

SCOPe Domain Coordinates for d1m56b1:

Click to download the PDB-style file with coordinates for d1m56b1.
(The format of our PDB-style files is described here.)

Timeline for d1m56b1: