SCOPe 2.04: Domain d1m56b1: 1m56 B:130-289

Lineage for d1m56b1 (1m56 B:130-289)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)

8. Domain d1m56b1: 1m56 B:130-289 [74472]
   Other proteins in same PDB: d1m56a_, d1m56b2, d1m56c_, d1m56d_, d1m56g_, d1m56h2, d1m56i_, d1m56j_
   complexed with ca, cu, hea, mg, peh

Details for d1m56b1

PDB Entry: 1m56, 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1m56b1:

Sequence; same for both SEQRES and ATOM records:

>d1m56b1 b.6.1.2 (B:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqarggtyel

Timeline for d1m56b1:

• d1m56b1 first appeared in SCOP 1.61
  
• d1m56b1 appears in SCOPe 2.03
  
• d1m56b1 appears in SCOPe 2.05
  
• d1m56b1 appears in the current release, SCOPe 2.08