Lineage for d1m56b1 (1m56 B:130-289)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553894Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 553895Protein Cytochrome c oxidase [49544] (4 species)
  7. 553914Species Rhodobacter sphaeroides [TaxId:1063] [74870] (2 PDB entries)
  8. 553915Domain d1m56b1: 1m56 B:130-289 [74472]
    Other proteins in same PDB: d1m56a_, d1m56b2, d1m56c_, d1m56d_, d1m56g_, d1m56h2, d1m56i_, d1m56j_

Details for d1m56b1

PDB Entry: 1m56 (more details), 2.3 Å

PDB Description: structure of cytochrome c oxidase from rhodobactor sphaeroides (wild type)

SCOP Domain Sequences for d1m56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m56b1 b.6.1.2 (B:130-289) Cytochrome c oxidase {Rhodobacter sphaeroides}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqarggtyel

SCOP Domain Coordinates for d1m56b1:

Click to download the PDB-style file with coordinates for d1m56b1.
(The format of our PDB-style files is described here.)

Timeline for d1m56b1: