Lineage for d1m4vb2 (1m4v B:101-204)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189555Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 189556Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 189659Protein Superantigen-like protein SET3 [75370] (1 species)
  7. 189660Species Staphylococcus aureus [TaxId:1280] [75371] (1 PDB entry)
  8. 189662Domain d1m4vb2: 1m4v B:101-204 [74462]
    Other proteins in same PDB: d1m4va1, d1m4vb1

Details for d1m4vb2

PDB Entry: 1m4v (more details), 1.9 Å

PDB Description: Crystal structure of SET3, a superantigen-like protein from Staphylococcus aureus

SCOP Domain Sequences for d1m4vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4vb2 d.15.6.1 (B:101-204) Superantigen-like protein SET3 {Staphylococcus aureus}
ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk
dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir

SCOP Domain Coordinates for d1m4vb2:

Click to download the PDB-style file with coordinates for d1m4vb2.
(The format of our PDB-style files is described here.)

Timeline for d1m4vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4vb1