![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Superantigen-like protein SET3 [75370] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [75371] (1 PDB entry) |
![]() | Domain d1m4va2: 1m4v A:101-204 [74460] Other proteins in same PDB: d1m4va1, d1m4vb1 |
PDB Entry: 1m4v (more details), 1.9 Å
SCOP Domain Sequences for d1m4va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4va2 d.15.6.1 (A:101-204) Superantigen-like protein SET3 {Staphylococcus aureus} ayydylnapkfvikkevdagvythvkrhyiykeevslkeldfklrqyliqnfdlykkfpk dskikvimkdggyytfelnkklqphrmsdvidgrniekmeanir
Timeline for d1m4va2: