SCOPe 2.07: Domain d1m4va1: 1m4v A:5-100

Lineage for d1m4va1 (1m4v A:5-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Superantigen-like protein SET3 [74946] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [74947] (3 PDB entries)

8. Domain d1m4va1: 1m4v A:5-100 [74459]
   Other proteins in same PDB: d1m4va2, d1m4vb2

Details for d1m4va1

PDB Entry: 1m4v, 1.9 Å

PDB Description: Crystal structure of SET3, a superantigen-like protein from Staphylococcus aureus

PDB Compounds: (A:) SET3, superantigen-like protein

SCOPe Domain Sequences for d1m4va1:

Sequence, based on SEQRES records:

>d1m4va1 b.40.2.2 (A:5-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
lktrknpgldifvvkeaenrngtvfsyggvtkknqg

Sequence, based on observed residues (ATOM records):

>d1m4va1 b.40.2.2 (A:5-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
lktrknpgldifvvkeaetvfsyggvtkknqg

Timeline for d1m4va1:

• d1m4va1 first appeared in SCOP 1.61
  
• d1m4va1 appears in SCOPe 2.06
  
• d1m4va1 appears in the current release, SCOPe 2.08