Lineage for d1m4va1 (1m4v A:5-100)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 229049Protein Superantigen-like protein SET3 [74946] (1 species)
  7. 229050Species Staphylococcus aureus [TaxId:1280] [74947] (1 PDB entry)
  8. 229051Domain d1m4va1: 1m4v A:5-100 [74459]
    Other proteins in same PDB: d1m4va2, d1m4vb2

Details for d1m4va1

PDB Entry: 1m4v (more details), 1.9 Å

PDB Description: Crystal structure of SET3, a superantigen-like protein from Staphylococcus aureus

SCOP Domain Sequences for d1m4va1:

Sequence, based on SEQRES records: (download)

>d1m4va1 b.40.2.2 (A:5-100) Superantigen-like protein SET3 {Staphylococcus aureus}
akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
lktrknpgldifvvkeaenrngtvfsyggvtkknqg

Sequence, based on observed residues (ATOM records): (download)

>d1m4va1 b.40.2.2 (A:5-100) Superantigen-like protein SET3 {Staphylococcus aureus}
akyenvtkdifdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdier
lktrknpgldifvvkeaetvfsyggvtkknqg

SCOP Domain Coordinates for d1m4va1:

Click to download the PDB-style file with coordinates for d1m4va1.
(The format of our PDB-style files is described here.)

Timeline for d1m4va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4va2