Lineage for d1m40a_ (1m40 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690477Protein beta-Lactamase, class A [56606] (16 species)
  7. 1690502Species Escherichia coli, TEM-1 [TaxId:562] [56607] (37 PDB entries)
  8. 1690503Domain d1m40a_: 1m40 A: [74437]
    ultra high resolution structure
    complexed with cb4, k, po4

Details for d1m40a_

PDB Entry: 1m40 (more details), 0.85 Å

PDB Description: ultra high resolution crystal structure of tem-1
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1m40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m40a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1m40a_:

Click to download the PDB-style file with coordinates for d1m40a_.
(The format of our PDB-style files is described here.)

Timeline for d1m40a_: