SCOPe 2.06: Domain d1m3xl_: 1m3x L:

Lineage for d1m3xl_ (1m3x L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
   Uniprot P02954

8. Domain d1m3xl_: 1m3x L: [74435]
   Other proteins in same PDB: d1m3xh1, d1m3xh2, d1m3xm_
   complexed with bcl, bph, cdl, cl, fe, ggd, pc1, spo, u10

Details for d1m3xl_

PDB Entry: 1m3x, 2.55 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (L:) Photosynthetic Reaction center protein L chain

SCOPe Domain Sequences for d1m3xl_:

Sequence; same for both SEQRES and ATOM records:

>d1m3xl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1m3xl_:

• d1m3xl_ first appeared in SCOP 1.61, called d1m3xl1
  
• d1m3xl_ appears in SCOPe 2.05
  
• d1m3xl_ appears in SCOPe 2.07
  
• d1m3xl_ appears in the current release, SCOPe 2.08