SCOP 1.75: Domain d1m3xh1: 1m3x H:36-248

Lineage for d1m3xh1 (1m3x H:36-248)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
   Uniprot P11846

8. Domain d1m3xh1: 1m3x H:36-248 [74433]
   Other proteins in same PDB: d1m3xh2, d1m3xl_, d1m3xm_
   complexed with bcl, bph, cdl, cl, fe, ggd, pc2, spo, u10

Details for d1m3xh1

PDB Entry: 1m3x, 2.55 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (H:) Photosynthetic reaction center protein H chain

SCOP Domain Sequences for d1m3xh1:

Sequence; same for both SEQRES and ATOM records:

>d1m3xh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d1m3xh1:

• d1m3xh1 first appeared in SCOP 1.61
  
• d1m3xh1 appears in SCOP 1.73
  
• d1m3xh1 appears in SCOPe 2.01
  
• d1m3xh1 appears in the current release, SCOPe 2.08