Lineage for d1m2ya_ (1m2y A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344326Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 344327Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 344328Protein Rubredoxin [57804] (6 species)
  7. 344329Species Archaeon Pyrococcus furiosus [TaxId:2261] [57809] (10 PDB entries)
  8. 344338Domain d1m2ya_: 1m2y A: [74432]
    mutant

Details for d1m2ya_

PDB Entry: 1m2y (more details)

PDB Description: Backbone NMR structure of a mutant P. furiosus rubredoxin using residual dipolar couplings

SCOP Domain Sequences for d1m2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2ya_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus}
akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefek

SCOP Domain Coordinates for d1m2ya_:

Click to download the PDB-style file with coordinates for d1m2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1m2ya_: