Lineage for d1m1xb3 (1m1x B:606-690)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739713Fold d.200: Integrin beta tail domain [69686] (1 superfamily)
    alpha-beta-loop-beta(3); loop across free side of beta-sheet
  4. 739714Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) (S)
  5. 739715Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)
  6. 739716Protein Integrin beta tail domain [69689] (1 species)
  7. 739717Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries)
  8. 739718Domain d1m1xb3: 1m1x B:606-690 [74428]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xb3

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (B:) integrin beta-3

SCOP Domain Sequences for d1m1xb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

SCOP Domain Coordinates for d1m1xb3:

Click to download the PDB-style file with coordinates for d1m1xb3.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb3: