SCOP 1.61: Domain d1m1xb3: 1m1x B:606-690

Lineage for d1m1xb3 (1m1x B:606-690)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.200: Integrin beta tail domain [69686] (1 superfamily)

4. Superfamily d.200.1: Integrin beta tail domain [69687] (1 family)

5. Family d.200.1.1: Integrin beta tail domain [69688] (1 protein)

6. Protein Integrin beta tail domain [69689] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69690] (3 PDB entries)

8. Domain d1m1xb3: 1m1x B:606-690 [74428]
   Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb4, d1m1xb5

Details for d1m1xb3

PDB Entry: 1m1x, 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xb3:

Sequence; same for both SEQRES and ATOM records:

>d1m1xb3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens)}
dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv
rfqyyedssgksilyvveepecpkg

Timeline for d1m1xb3:

• d1m1xb3 is new in SCOP 1.61
  
• d1m1xb3 appears in SCOP 1.63
  
• d1m1xb3 appears in the current release, SCOPe 2.08