Lineage for d1m1xb1 (1m1x B:55-106,B:355-434)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161756Superfamily b.1.15: Integrin domains [69179] (1 family) (S)
  5. 161757Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 161758Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 161759Species Human (Homo sapiens) [TaxId:9606] [69184] (3 PDB entries)
  8. 161760Domain d1m1xb1: 1m1x B:55-106,B:355-434 [74426]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5

Details for d1m1xb1

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+

SCOP Domain Sequences for d1m1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens)}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOP Domain Coordinates for d1m1xb1:

Click to download the PDB-style file with coordinates for d1m1xb1.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb1: