Lineage for d1m1xb1 (1m1x B:55-106,B:355-434)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764934Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2764935Protein Hybrid domain of integrin beta [69183] (1 species)
  7. 2764936Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
    Uniprot P05106 27-466
  8. 2764946Domain d1m1xb1: 1m1x B:55-106,B:355-434 [74426]
    Other proteins in same PDB: d1m1xa1, d1m1xa2, d1m1xa3, d1m1xa4, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xb1

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1m1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xb1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

SCOPe Domain Coordinates for d1m1xb1:

Click to download the PDB-style file with coordinates for d1m1xb1.
(The format of our PDB-style files is described here.)

Timeline for d1m1xb1: