Lineage for d1m1xa1 (1m1x A:439-598)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038467Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2038468Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2038482Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 2038483Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
    Uniprot P06756 31-986
  8. 2038484Domain d1m1xa1: 1m1x A:439-598 [74422]
    Other proteins in same PDB: d1m1xa4, d1m1xb1, d1m1xb2, d1m1xb3, d1m1xb4, d1m1xb5
    complexed with mn, nag

Details for d1m1xa1

PDB Entry: 1m1x (more details), 3.3 Å

PDB Description: crystal structure of the extracellular segment of integrin alpha vbeta3 bound to mn2+
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d1m1xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1xa1 b.1.15.1 (A:439-598) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahilldcge

SCOPe Domain Coordinates for d1m1xa1:

Click to download the PDB-style file with coordinates for d1m1xa1.
(The format of our PDB-style files is described here.)

Timeline for d1m1xa1: