Lineage for d1m1ua_ (1m1u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892209Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2892210Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)
  8. 2892214Domain d1m1ua_: 1m1u A: [74421]
    complexed with ca

Details for d1m1ua_

PDB Entry: 1m1u (more details), 2.3 Å

PDB Description: an isoleucine-based allosteric switch controls affinity and shape shifting in integrin cd11b a-domain
PDB Compounds: (A:) Integrin alpha-M

SCOPe Domain Sequences for d1m1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ua_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrek

SCOPe Domain Coordinates for d1m1ua_:

Click to download the PDB-style file with coordinates for d1m1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ua_: