Lineage for d1m1kw_ (1m1k W:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 531983Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 531989Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 531990Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 531991Protein Ribosomal protein L29 (L29p) [46563] (2 species)
  7. 531992Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (19 PDB entries)
  8. 532010Domain d1m1kw_: 1m1k W: [74405]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kw_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1kw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1m1kw_:

Click to download the PDB-style file with coordinates for d1m1kw_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kw_: