Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L21e [50108] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries) Uniprot P12734 |
Domain d1m1kr_: 1m1k R: [74400] Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_ complexed with cd, cl, k, mg, na, zit |
PDB Entry: 1m1k (more details), 3.2 Å
SCOPe Domain Sequences for d1m1kr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1kr_ b.34.5.1 (R:) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d1m1kr_:
View in 3D Domains from other chains: (mouse over for more information) d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_ |