Lineage for d1m1ko_ (1m1k O:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397977Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 397978Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 397979Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 397980Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (18 PDB entries)
  8. 397997Domain d1m1ko_: 1m1k O: [74397]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1ko_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui

SCOP Domain Sequences for d1m1ko_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ko_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1m1ko_:

Click to download the PDB-style file with coordinates for d1m1ko_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ko_: