Lineage for d1m1kh_ (1m1k H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727493Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 727494Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 727506Protein Ribosomal protein L7ae [55319] (4 species)
  7. 727510Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)
  8. 727533Domain d1m1kh_: 1m1k H: [74390]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1ke_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1kh_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (H:) ribosomal protein l7ae

SCOP Domain Sequences for d1m1kh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1kh_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1m1kh_:

Click to download the PDB-style file with coordinates for d1m1kh_.
(The format of our PDB-style files is described here.)

Timeline for d1m1kh_: