Lineage for d1m1ke_ (1m1k E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837604Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 1837605Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
    automatically mapped to Pfam PF00573
  5. 1837606Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 1837607Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 1837645Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
    Uniprot P12735
  8. 1837683Domain d1m1ke_: 1m1k E: [74386]
    Other proteins in same PDB: d1m1k1_, d1m1k2_, d1m1k3_, d1m1k4_, d1m1kc1, d1m1kc2, d1m1kd_, d1m1kf_, d1m1kg1, d1m1kg2, d1m1kh_, d1m1ki_, d1m1kj_, d1m1kk_, d1m1kl_, d1m1km_, d1m1kn_, d1m1ko_, d1m1kp_, d1m1kq_, d1m1kr_, d1m1ks_, d1m1kt_, d1m1ku_, d1m1kv_, d1m1kw_, d1m1kx_, d1m1ky_, d1m1kz_
    complexed with cd, cl, k, mg, na, zit

Details for d1m1ke_

PDB Entry: 1m1k (more details), 3.2 Å

PDB Description: Co-crystal structure of azithromycin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (E:) ribosomal protein l4

SCOPe Domain Sequences for d1m1ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1ke_ c.22.1.1 (E:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOPe Domain Coordinates for d1m1ke_:

Click to download the PDB-style file with coordinates for d1m1ke_.
(The format of our PDB-style files is described here.)

Timeline for d1m1ke_: