Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (29 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [88899] (1 PDB entry) |
Domain d1m1jc2: 1m1j C:4-141 [74373] Other proteins in same PDB: d1m1ja_, d1m1jb1, d1m1jb2, d1m1jc1, d1m1jd_, d1m1je1, d1m1je2, d1m1jf1 |
PDB Entry: 1m1j (more details), 2.7 Å
SCOP Domain Sequences for d1m1jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m1jc2 h.1.8.1 (C:4-141) Fibrinogen gamma chain {Chicken (Gallus gallus)} trenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqh iktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitq lkqkiaqleshcqepckd
Timeline for d1m1jc2: