SCOP 1.71: Domain d1m1jc2: 1m1j C:4-141

Lineage for d1m1jc2 (1m1j C:4-141)

Root: SCOP 1.71
Class h: Coiled coil proteins [57942] (7 folds)
Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
Protein Fibrinogen gamma chain [88898] (4 species)
Species Chicken (Gallus gallus) [TaxId:9031] [88899] (1 PDB entry)
Domain d1m1jc2: 1m1j C:4-141 [74373]
Other proteins in same PDB: d1m1ja_, d1m1jb1, d1m1jb2, d1m1jc1, d1m1jd_, d1m1je1, d1m1je2, d1m1jf1

Details for d1m1jc2

PDB Entry: 1m1j (more details), 2.7 Å

PDB Description: crystal structure of native chicken fibrinogen with two different bound ligands

SCOP Domain Sequences for d1m1jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m1jc2 h.1.8.1 (C:4-141) Fibrinogen gamma chain {Chicken (Gallus gallus)}
trenccilderfgsycpttcgiadffnkyrlttdgelleiegllqqatnstgsieyliqh
iktiypsekqtlpqsieqltqkskkiieeiiryentilahentiqqltdmhimnsnkitq
lkqkiaqleshcqepckd

SCOP Domain Coordinates for d1m1jc2:

Click to download the PDB-style file with coordinates for d1m1jc2.
(The format of our PDB-style files is described here.)

Timeline for d1m1jc2: