SCOPe 2.06: Domain d1m10a_: 1m10 A:

Lineage for d1m10a_ (1m10 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)

8. Domain d1m10a_: 1m10 A: [74361]
   Other proteins in same PDB: d1m10b_
   complexed with glycoprotein Ib alpha domain

Details for d1m10a_

PDB Entry: 1m10, 3.1 Å

PDB Description: crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1m10a_:

Sequence; same for both SEQRES and ATOM records:

>d1m10a_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
hdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrisqkwvrvavveyhdgsha
yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
qqrdeivsylcdlapeapp

Timeline for d1m10a_:

• d1m10a_ first appeared in SCOP 1.61
  
• d1m10a_ appears in SCOPe 2.05
  
• d1m10a_ appears in SCOPe 2.07
  
• d1m10a_ appears in the current release, SCOPe 2.08