Lineage for d1m10a_ (1m10 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892325Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 2892326Species Human (Homo sapiens) [TaxId:9606] [53307] (11 PDB entries)
  8. 2892337Domain d1m10a_: 1m10 A: [74361]
    Other proteins in same PDB: d1m10b_
    complexed with glycoprotein Ib alpha domain

Details for d1m10a_

PDB Entry: 1m10 (more details), 3.1 Å

PDB Description: crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1m10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m10a_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
hdfycsrlldlvflldgssrlseaefevlkafvvdmmeqlrisqkwvrvavveyhdgsha
yiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmas
qepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdele
qqrdeivsylcdlapeapp

SCOPe Domain Coordinates for d1m10a_:

Click to download the PDB-style file with coordinates for d1m10a_.
(The format of our PDB-style files is described here.)

Timeline for d1m10a_: