SCOP 1.63: Domain d1lycb_: 1lyc B:

Lineage for d1lycb_ (1lyc B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (6 proteins)

6. Protein Peroxidase [48117] (2 species)

7. Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (4 PDB entries)

8. Domain d1lycb_: 1lyc B: [74345]
   complexed with ca, hem

Details for d1lycb_

PDB Entry: 1lyc, 1.57 Å

PDB Description: the impact of the physical and chemical enviroment on the molecular structure of coprinus cinereus peroxidase

SCOP Domain Sequences for d1lycb_:

Sequence; same for both SEQRES and ATOM records:

>d1lycb_ a.93.1.1 (B:) Peroxidase {Inky cap (Coprinus cinereus)}
svtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkilrivfhdaigfspaltaa
gqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfatavgmsn
cpgsprlefltgrssssqpsppslipgpgntvtaildrmgdagfspdevvdllaahslas
qeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpgefrmrsdal
lardsrtacrwqsmtssnevmgqryraamakmsvlgfdrnaltdcsdvipsavsnnaapv
ipggltvddievscpsepfpeiaaasgplpalapap

Timeline for d1lycb_:

• d1lycb_ first appeared in SCOP 1.61
  
• d1lycb_ appears in SCOP 1.65
  
• d1lycb_ appears in the current release, SCOPe 2.08