SCOP 1.75: Domain d1ly8b_: 1ly8 B:

Lineage for d1ly8b_ (1ly8 B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Fungal peroxidase (ligninase) [88935] (4 species)

7. Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)

8. Domain d1ly8b_: 1ly8 B: [74341]
   complexed with ca, gol, hem, man, nag; mutant

Details for d1ly8b_

PDB Entry: 1ly8, 2.05 Å

PDB Description: the crystal structure of a mutant enzyme of coprinus cinereus peroxidase provides an understanding of its increased thermostability and insight into modelling of protein structures

PDB Compounds: (B:) Peroxidase

SCOP Domain Sequences for d1ly8b_:

Sequence; same for both SEQRES and ATOM records:

>d1ly8b_ a.93.1.1 (B:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
ggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkslriafhdaigfspalt
aagqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfaaavgm
sncpgsprlefltgrsnssqpsppslipgpgntvtaildrfgdagfspdevvdllaahsl
asqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpggfrirsd
allardsrtacrwqsmtssnevmgqrfraamakmsvlgfdrnaltdcsdvipsavsnnaa
pvipggltvddievscpsepfpeiatasgplpslapap

Timeline for d1ly8b_:

• d1ly8b_ first appeared in SCOP 1.61
  
• d1ly8b_ appears in SCOP 1.73
  
• d1ly8b_ appears in SCOPe 2.01
  
• d1ly8b_ appears in the current release, SCOPe 2.08