Lineage for d1ly8a_ (1ly8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005360Protein Fungal peroxidase (ligninase) [88935] (3 species)
  7. 2005391Species Inky cap (Coprinus cinereus) [TaxId:5346] [74752] (5 PDB entries)
  8. 2005400Domain d1ly8a_: 1ly8 A: [74340]
    complexed with bma, ca, gol, hem, man, nag; mutant

Details for d1ly8a_

PDB Entry: 1ly8 (more details), 2.05 Å

PDB Description: the crystal structure of a mutant enzyme of coprinus cinereus peroxidase provides an understanding of its increased thermostability and insight into modelling of protein structures
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1ly8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ly8a_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {Inky cap (Coprinus cinereus) [TaxId: 5346]}
gggsvtcpggqstsnsqccvwfdvlddlqtnfyqgskcespvrkslriafhdaigfspal
taagqfggggadgsiiahsnielafpanggltdtvealravginhgvsfgdliqfaaavg
msncpgsprlefltgrsnssqpsppslipgpgntvtaildrfgdagfspdevvdllaahs
lasqeglnsaifrspldstpqvfdtqfyietllkgttqpgpslgfaeelspfpggfrirs
dallardsrtacrwqsmtssnevmgqrfraamakmsvlgfdrnaltdcsdvipsavsnna
apvipggltvddievscpsepfpeiatasgplpslapap

SCOPe Domain Coordinates for d1ly8a_:

Click to download the PDB-style file with coordinates for d1ly8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ly8a_: