SCOPe 2.07: Domain d1ly2a1: 1ly2 A:2-66

Lineage for d1ly2a1 (1ly2 A:2-66)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement receptor 2, cr2 [64564] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)

8. Domain d1ly2a1: 1ly2 A:2-66 [74335]
   Other proteins in same PDB: d1ly2a3, d1ly2a4
   complexed with nag

Details for d1ly2a1

PDB Entry: 1ly2, 1.8 Å

PDB Description: crystal structure of unliganded human cd21 scr1-scr2 (complement receptor type 2)

PDB Compounds: (A:) complement receptor type 2

SCOPe Domain Sequences for d1ly2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ly2a1 g.18.1.1 (A:2-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
scgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpapk
ceyfn

Timeline for d1ly2a1:

• d1ly2a1 first appeared in SCOP 1.61
  
• d1ly2a1 appears in SCOPe 2.06
  
• d1ly2a1 appears in the current release, SCOPe 2.08