SCOP 1.71: Domain d1lwuk2: 1lwu K:163-218

Lineage for d1lwuk2 (1lwu K:163-218)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [88897] (2 PDB entries)

8. Domain d1lwuk2: 1lwu K:163-218 [74326]
   Other proteins in same PDB: d1lwua_, d1lwub1, d1lwuc1, d1lwuc2, d1lwud_, d1lwue1, d1lwuf1, d1lwuf2, d1lwug_, d1lwuh1, d1lwui1, d1lwui2, d1lwuj_, d1lwuk1, d1lwul1, d1lwul2
   coiled-coil region only
   complexed with ca, gal, man, nag, nh2

Details for d1lwuk2

PDB Entry: 1lwu, 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide

SCOP Domain Sequences for d1lwuk2:

Sequence; same for both SEQRES and ATOM records:

>d1lwuk2 h.1.8.1 (K:163-218) Fibrinogen beta chain {Sea lamprey (Petromyzon marinus)}
aqkeienrykevkiriestvagslrsmksvlehlrakmqrmeeaiktqkelcsapc

Timeline for d1lwuk2:

• d1lwuk2 first appeared in SCOP 1.61
  
• d1lwuk2 appears in SCOP 1.69
  
• d1lwuk2 appears in SCOP 1.73
  
• d1lwuk2 appears in the current release, SCOPe 2.08