SCOP 1.63: Domain d1lwui2: 1lwu I:83-137

Lineage for d1lwui2 (1lwu I:83-137)

1. Root: SCOP 1.63

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)

6. Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
   in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails

7. Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [75698] (2 PDB entries)

8. Domain d1lwui2: 1lwu I:83-137 [74323]
   Other proteins in same PDB: d1lwub1, d1lwuc1, d1lwue1, d1lwuf1, d1lwuh1, d1lwui1, d1lwuk1, d1lwul1

Details for d1lwui2

PDB Entry: 1lwu, 2.8 Å

PDB Description: crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide

SCOP Domain Sequences for d1lwui2:

Sequence; same for both SEQRES and ATOM records:

>d1lwui2 h.1.8.1 (I:83-137) Fibrinogen coiled-coil and central regions {Sea lamprey (Petromyzon marinus)}
ktvqkileevrileqigvshdaqiqelsemwrvnqqfvtrlqqqlvdirqtcsrp

Timeline for d1lwui2:

• d1lwui2 first appeared in SCOP 1.61
  
• d1lwui2 appears in SCOP 1.65
  
• d1lwui2 appears in the current release, SCOPe 2.08