Lineage for d1lwuh1 (1lwu H:219-477)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264784Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 264785Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 264786Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 264787Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 264851Species Sea lamprey (Petromyzon marinus), beta [TaxId:7757] [75588] (2 PDB entries)
  8. 264854Domain d1lwuh1: 1lwu H:219-477 [74320]
    Other proteins in same PDB: d1lwua_, d1lwub2, d1lwuc2, d1lwud_, d1lwue2, d1lwuf2, d1lwug_, d1lwuh2, d1lwui2, d1lwuj_, d1lwuk2, d1lwul2

Details for d1lwuh1

PDB Entry: 1lwu (more details), 2.8 Å

PDB Description: Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide

SCOP Domain Sequences for d1lwuh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwuh1 d.171.1.1 (H:219-477) Fibrinogen C-terminal domains {Sea lamprey (Petromyzon marinus), beta}
tvncrvpvvsgmhcediyrnggrtseayyiqpdlfsepykvfcdmeshgggwtvvqnrvd
gssnfardwntykaefgniafgngksicnipgeywlgtktvhqltkqhtqqvlfdmsdwe
gssvyaqyasfrpeneaqgyrlwvedysgnagnallegatqlmgdnrtmtihngmqfstf
drdndnwnpgdptkhcsredaggwwynrchaanpngryywggiytkeqadygtddgvvwm
nwkgswysmrqmamklrpk

SCOP Domain Coordinates for d1lwuh1:

Click to download the PDB-style file with coordinates for d1lwuh1.
(The format of our PDB-style files is described here.)

Timeline for d1lwuh1: